Last updated: September 28, 2026. Added what LL-37 is and where it comes from, what has and hasn’t been studied in people, its FDA status, and how to check a vial’s certificate.
LL-37 Peptide is a naturally occurring antimicrobial peptide and the only identified human member of the cathelicidin family. It is produced by immune cells such as neutrophils, macrophages, and epithelial cells, acting as a first-response defense mechanism against harmful pathogens. Unlike traditional antibiotics, which target specific bacterial processes, LL-37 works by physically disrupting microbial membranes and modulating immune responses.
What makes LL-37 particularly interesting is its dual role. On one side, it directly kills microbes; on the other, it regulates how aggressively your immune system reacts. This balance is critical because an overactive immune system can cause chronic inflammation, tissue damage, and autoimmune complications. Therefore, LL-37 is not just about killing pathogens—it is about maintaining immune equilibrium.
Additionally, LL-37 Peptide is naturally present in areas of the body that are constantly exposed to external threats, such as the skin, lungs, and gastrointestinal tract. This distribution highlights its importance in maintaining barrier protection. However, increasing its levels artificially through external administration changes how the body behaves, which is why controlled dosing becomes essential.
What Is LL-37?
LL-37 is the only cathelicidin the human body makes. It starts life as part of a larger precursor protein called hCAP18, and LL-37 is the 37-amino-acid piece cut from its tail end. The name describes it: the first two amino acids are leucines (the “LL”), and it is 37 amino acids long.
The body makes it mainly in neutrophils, a type of white blood cell, and in the epithelial cells that line the skin, airways and gut. Lab work has also shown that vitamin D switches on cathelicidin production in human immune cells (Liu et al., Science, 2006).
| Sequence | [LL-37, 37 aa] |
| Length | 37 amino acids |
| Molecular formula | C205H340N60O53 |
| Molecular weight | 4493.37 g/mol |
| CAS number | 597562-32-8 |
| Precursor protein | hCAP18 (human cationic antimicrobial protein, 18 kDa) |
| Family | Cathelicidin, the only one found in humans |
| Approval status | Not approved by the FDA for any use |
How LL-37 Works in the Body
Direct Antimicrobial Activity
LL-37 functions by attaching to the outer membranes of pathogens and breaking them apart. This action leads to rapid destruction of bacteria and other microbes. Because this mechanism is physical rather than biochemical, pathogens find it harder to develop resistance against LL-37 compared to conventional antibiotics.
Moreover, LL-37 has demonstrated effectiveness in disrupting biofilms. Biofilms are protective layers formed by bacteria that make infections more difficult to treat. By penetrating these layers, LL-37 may help expose hidden pathogens that would otherwise remain resistant to treatment.
However, its antimicrobial effectiveness depends heavily on concentration and environment. Too little may produce minimal results, while excessive levels could irritate tissues or overstimulate immune responses. This is exactly why precise dosing is critical.
Immune System Modulation
LL-37 plays a sophisticated role in immune signaling. It interacts with immune cells and influences the release of cytokines, which are chemical messengers that guide immune responses. Instead of simply boosting immunity, LL-37 helps fine-tune it.
For example, in situations where inflammation is too high, LL-37 may help reduce excessive immune activity. On the other hand, in cases of weak immune response, it may enhance the body’s ability to fight infections. This adaptability is one of its most valuable characteristics.
In addition, LL-37 has been studied for its role in bridging innate and adaptive immunity. This means it may help the body transition from immediate defense mechanisms to long-term immune memory. While this sounds beneficial, it also means misuse can disrupt normal immune balance, which is not something to take lightly.
Tissue Repair and Regeneration
LL-37 is not limited to immune defense—it also plays a role in tissue healing. It promotes cell migration, which is essential for closing wounds and regenerating damaged tissues. Furthermore, it stimulates angiogenesis, allowing new blood vessels to form and deliver nutrients to healing areas.
Another important function is its ability to influence collagen production. Collagen is a key structural protein in the body, and its proper regulation is crucial for healthy skin and tissue integrity. LL-37 may help improve wound healing outcomes by supporting this process.
Because of these effects, LL-37 is being studied in chronic wound care, diabetic ulcers, and post-surgical recovery. However, again, the key factor remains controlled and appropriate dosing.
LL-37 Dosage Chart
Standard LL-37 Dosage Guidelines
| Experience Level | Dose | Frequency | Cycle Length |
|---|---|---|---|
| Beginner | 50 mcg | Once daily | 2–4 weeks |
| Intermediate | 100 mcg | Once daily | 4–6 weeks |
| Advanced | 100–200 mcg | Once daily | 4–8 weeks |
These dosage ranges are based on research observations and are not universally standardized. Therefore, starting low and adjusting carefully is the only sensible approach.
Another important point is individual variability. Factors such as body weight, immune status, and overall health can influence how someone responds to LL-37. What works for one person may not work the same way for another.
Why Published LL-37 Numbers Disagree
LL-37 figures online rarely line up, because they come from very different kinds of work. Cell and lab studies report concentrations in a dish, not amounts for a person. The one substantial human trial applied LL-37 to the skin as a solution, so its figures are concentrations too. Vendor and forum schedules don’t come from trials. And vials are sold in different sizes, so the same volume holds a different amount depending on the vial.
Before trusting any LL-37 number, ask which of those it came from.
LL-37 Dosage Calculator
Step-by-Step Breakdown
Example Setup:
- Vial: 10 mg LL-37
- Dilution: 10 mL bacteriostatic water
Final Concentration:
10 mg ÷ 10 mL = 1 mg/mL
Now convert desired dose:
| Dose | Injection Volume |
|---|---|
| 50 mcg | 0.05 mL |
| 100 mcg | 0.1 mL |
| 200 mcg | 0.2 mL |
Additional Insight
Many beginners underestimate how critical accurate measurement is. Using improper syringes or eyeballing doses leads to inconsistent results. Precision is not optional here—it directly determines both safety and effectiveness.
Best Timing for LL-37
Consistency remains the most important factor. Taking LL-37 at the same time daily helps maintain stable levels in the body, which improves predictability of results.
Morning dosing may align better with immune activation during the day, while evening dosing may support repair processes that occur during sleep. However, there is no universal rule, and results often depend on the specific goal of use.
Another factor to consider is lifestyle. Sleep quality, diet, and stress levels all influence how LL-37 performs. Ignoring these while expecting optimal results is unrealistic.
Injection Method and Technique
LL-37 is typically administered via subcutaneous injection. Proper technique ensures better absorption and reduces complications.
Important practices include:
- Using sterile syringes every time
- Rotating injection sites to prevent irritation
- Injecting at the correct depth under the skin
Poor injection habits can lead to infections, inconsistent dosing, and reduced effectiveness. This is one of the most overlooked areas, yet it has a direct impact on outcomes.
Cycle Strategy and Long-Term Use
Continuous use of LL-37 is not recommended. The body adapts quickly, and prolonged exposure may lead to reduced effectiveness or unwanted immune responses.
Typical cycle:
- 2–6 weeks ON
- 2–4 weeks OFF
Taking breaks allows the body to reset and reduces the risk of overstimulation. Skipping this step is one of the most common mistakes people make.
Expanded Benefits of LL-37
Immune Optimization
LL-37 helps the body respond more efficiently to infections without causing unnecessary inflammation. This balance is critical for long-term health.
Infection Control
Its ability to disrupt microbial membranes makes it effective against a wide range of pathogens, including those that form protective biofilms.
Tissue Healing
LL-37 supports faster recovery by improving blood flow, cell growth, and collagen formation.
Inflammation Regulation
Chronic inflammation is a root cause of many diseases. LL-37 may help regulate inflammatory responses, reducing long-term damage.
Risks and Side Effects
LL-37 is powerful, and that comes with risk.
Common Issues
- Injection site irritation
- Mild fatigue
- Temporary discomfort
More Serious Concerns
- Immune imbalance
- Increased inflammation in sensitive individuals
- Lack of long-term safety data
This is not something to experiment with casually. Misuse can create more problems than benefits.
What Has Been Studied in People, and What Hasn’t
Most human LL-37 research looks at the LL-37 the body already makes: where it is found, how its levels differ between people, and what switches its production on, such as vitamin D.
Studies that actually give people LL-37 are rare. The main one is a Phase IIb, double-blind, placebo-controlled trial in 148 patients with hard-to-heal venous leg ulcers, in which LL-37 was applied to the wound surface alongside compression therapy (Grönberg et al., 2014). Across the whole study population it did not produce a significant improvement over placebo. A later post hoc look found differences in a subgroup with large wounds, and the peptide was well tolerated at both strengths tested. A follow-up multicentre trial was published in 2022 (Wound Repair and Regeneration, 2022).
That trial applied LL-37 to the skin. There is no published human trial of LL-37 given by injection, which is how it is usually discussed online.
Is LL-37 FDA-Approved?
No. LL-37 is not approved by the FDA for any use.
The FDA has gone a step further with it. “Cathelicidin LL-37” sits in Category 2 of the FDA’s list of bulk drug substances nominated for compounding under Section 503A. Category 2 is where the FDA puts substances for which it has identified significant safety risks, and it has said it does not intend to let licensed pharmacies compound them while that evaluation continues (FDA interim policy).
How to Check an LL-37 Vial Before Trusting the Numbers
Every figure on this page assumes the vial contains what its label says. The certificate of analysis for that specific lot is the only way to know. A useful one shows:
- A lot number that matches the vial.
- The testing lab, the test date, and an accession or verification number you can check.
- Purity by HPLC, as a percentage.
- Identity by mass spectrometry, naming LL-37, with an observed mass consistent with its molecular weight of 4493.37.
- Net peptide content, the actual milligrams of peptide in the vial.
- An endotoxin screen.
Walk away if you see:
- No lot number, or one that doesn’t match the vial.
- A purity figure with no identity test.
- An identity test that names a different compound.
- One certificate reused across several products.
More detail is in our guide to reading a peptide certificate of analysis.
Frequently Asked Questions (FAQ)
What is LL-37 used for?
It is studied for immune support, antimicrobial effects, and wound healing.
What is the best starting dose?
Most protocols begin at 50 mcg daily.
How long should it be used?
Typically 2–6 weeks per cycle.
Is LL-37 safe?
Short-term use appears tolerable, but long-term safety remains unclear.
Conclusion
LL-37 is a complex and powerful peptide that offers potential benefits in immune defense, infection control, and tissue repair. However, it requires a disciplined and informed approach.
If you want real results:
- Focus on precision
- Follow structured cycles
- Avoid guesswork
- Respect the risks
Anything less is careless.
References
Dürr, U. H., Sudheendra, U. S., & Ramamoorthy, A. (2006). LL-37, the only human member of the cathelicidin family of antimicrobial peptides. Biochimica et Biophysica Acta, 1758(9), 1408–1425.
https://doi.org/10.1016/j.bbamem.2006.03.030
Nijnik, A., & Hancock, R. E. (2009). The roles of cathelicidin LL-37 in immune responses and inflammation. Journal of Innate Immunity, 1(5), 413–421.
https://doi.org/10.1159/000226245
National Library of Medicine. (2024). LL-37 peptide research overview.
https://pubmed.ncbi.nlm.nih.gov/39643165/
Liu, P. T., et al. (2006). Toll-like receptor triggering of a vitamin D-mediated human antimicrobial response. Science, 311(5768), 1770-1773.
https://pubmed.ncbi.nlm.nih.gov/16497887/
Grönberg, A., et al. (2014). Treatment with LL-37 is safe and effective in enhancing healing of hard-to-heal venous leg ulcers: a randomized, placebo-controlled clinical trial. Wound Repair and Regeneration.
https://pubmed.ncbi.nlm.nih.gov/25041740/
U.S. Food and Drug Administration. Interim Policy on Compounding Using Bulk Drug Substances Under Section 503A.
https://www.fda.gov/media/174456/download
